Structure of PDB 3sth Chain A

Receptor sequence

>3sthA (length=339) Species: 5811 (Toxoplasma gondii)

MVCKLGINGFGRIGRLVFRAAMERGDVEVLAINDPFMSLDYMVYLLRYDS
VHGHYPGEVSHKDGKLIVGGKAVTVFNEKEPTAIPWGQAGVHYICESTGI
FLTKEKAQAHLTNGAKKVIMSAPPKDDTPMFVMGVNNDQYKSSDVIVSNA
SCTTNCLAPLAKIVHDKFGIVEGLMTTVHAMTANQLTVDGPSKGGKDWRA
GRSAGVNIIPASTGAAKAVGKIIPSLNGKLTGMAFRVPVPDVSVVDLTCK
LAKPAKYEDIVAAVKEAATSGPMKGIISYTDEEVVSSDFVHCKFSSVFDI
NAGIMLNDTFVKLVSWYDNEWGYSNRLVELAHYMSVQDG

3D structure

• PDB: 3sth Membrane skeletal association and post-translational allosteric regulation of Toxoplasma gondii GAPDH1.
• Chain: A
• Resolution: 2.25 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): C152 H179
• Catalytic site (residue number reindexed from 1): C152 H179
• Enzyme Commision number: 1.2.1.12: glyceraldehyde-3-phosphate dehydrogenase (phosphorylating).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAD	A	N8 G9 G11 R12 I13 D34 P35 F36 S97 T98 G99 S121 C152 A183 N319 Y323	N8 G9 G11 R12 I13 D34 P35 F36 S97 T98 G99 S121 C152 A183 N319 Y323

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0004365 glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity
• GO:0016491 oxidoreductase activity
• GO:0016620 oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor
• GO:0050661 NADP binding
• GO:0051287 NAD binding

Biological Process

• GO:0006006 glucose metabolic process
• GO:0006096 glycolytic process

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:3sth, PDBe:3sth, PDBj:3sth
• PDBsum: 3sth
• PubMed: 27859784
• UniProt: Q9BKE2