Structure of PDB 3sjh Chain A

Receptor sequence

>3sjhA (length=357) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]

TALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQDSYVGDEAQSKRGI
LTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKA
NREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVP
IYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKE
KLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQP
SFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVMSGGTTMYPGIADRMQ
KEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWITKQEYDE
AGPSIVH

3D structure

PDB

3sjh How a single residue in individual beta-thymosin/WH2 domains controls their functions in actin assembly

Chain

Resolution

1.75 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

3.6.4.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	peptide	A	G23 D24 D25 A144 T148 E167 I341 I345 L349 S350 T351 Q354 M355	G18 D19 D20 A130 T134 E153 I327 I331 L335 S336 T337 Q340 M341
BS02	ATP	A	G13 S14 G15 K18 G156 D157 G158 V159 G182 R210 K213 E214 G302 M305 Y306	G8 S9 G10 K13 G142 D143 G144 V145 G168 R196 K199 E200 G288 M291 Y292
BS03	LAR	A	G15 L16 P32 I34 Q59 Y69 D157 R183 T186 R206 E207 R210	G10 L11 P27 I29 Q45 Y55 D143 R169 T172 R192 E193 R196

Gene Ontology

	Molecular Function
GO:0000287	magnesium ion binding
GO:0003785	actin monomer binding
GO:0005509	calcium ion binding
GO:0005515	protein binding
GO:0005523	tropomyosin binding
GO:0005524	ATP binding
GO:0016787	hydrolase activity
GO:0019904	protein domain specific binding
GO:0031013	troponin I binding
GO:0031432	titin binding
GO:0032036	myosin heavy chain binding
GO:0042802	identical protein binding
GO:0048306	calcium-dependent protein binding
GO:0140660	cytoskeletal motor activator activity

	Biological Process
GO:0010628	positive regulation of gene expression
GO:0030041	actin filament polymerization
GO:0030240	skeletal muscle thin filament assembly
GO:0048741	skeletal muscle fiber development
GO:0051017	actin filament bundle assembly
GO:0090131	mesenchyme migration

	Cellular Component
GO:0001725	stress fiber
GO:0005737	cytoplasm
GO:0005856	cytoskeleton
GO:0005865	striated muscle thin filament
GO:0005884	actin filament
GO:0030027	lamellipodium
GO:0030175	filopodium
GO:0031941	filamentous actin
GO:0032432	actin filament bundle
GO:0044297	cell body
GO:0098723	skeletal muscle myofibril

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3sjh, PDBe:3sjh, PDBj:3sjh
PDBsum	3sjh
PubMed	22193718
UniProt	P68135\|ACTS_RABIT Actin, alpha skeletal muscle (Gene Name=ACTA1)

[Back to BioLiP]