Structure of PDB 3sfh Chain A

Receptor sequence
>3sfhA (length=342) Species: 9606 (Homo sapiens) [Search protein sequence]
LVPVYIYSPEYVSMCDSLAKIPKRASMVHSLIEAYALHKQMRIVKPKVAS
MEEMATFHTDAYLQHLQKVSQGIFDYAAAIGGATITAAQCLIDGMCKVAI
NWSGGWHHAKKDEASGFCYLNDAVLGILRLRRKFERILYVDLDLHHGDGV
EDAFSFTSKVMTVSLHKFSPGFFPGTGDVSDVGLGKGRYYSVNVPIQDGI
QDEKYYQICESVLKEVYQAFNPKAVVLQLGADTIAGDPMCSFNMTPVGIG
KCLKYILQWQLATLILGGGGYNLANTARCWTYLTGVILGKTLSSEIPDHE
FFTAYGPDYVLEITPSCRPDRNEPHRIQQILNYIKGNLKHVV
3D structure
PDB3sfh Human HDAC isoform selectivity achieved via exploitation of the acetate release channel with structurally unique small molecule inhibitors.
ChainA
Resolution2.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.5.1.-
3.5.1.98: histone deacetylase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN A D178 H180 D267 D143 H145 D232
BS02 ACT A G107 D110 G72 D75
BS03 ACT A W141 C153 Y154 L155 W106 C118 Y119 L120
BS04 ACT A D267 D272 C275 S276 F277 D232 D237 C240 S241 F242
BS05 1DI A I34 R37 G140 W141 H142 H143 G151 F152 H180 F208 G303 G304 I21 R24 G105 W106 H107 H108 G116 F117 H145 F173 G268 G269 PDBbind-CN: -logKd/Ki=7.05,IC50=90nM
BindingDB: IC50=90nM
Gene Ontology
Molecular Function
GO:0004407 histone deacetylase activity
GO:0005515 protein binding
GO:0016787 hydrolase activity
GO:0030544 Hsp70 protein binding
GO:0033558 protein lysine deacetylase activity
GO:0046872 metal ion binding
GO:0051879 Hsp90 protein binding
GO:0140297 DNA-binding transcription factor binding
GO:0160008 protein decrotonylase activity
GO:0160009 histone decrotonylase activity
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0006325 chromatin organization
GO:0007064 mitotic sister chromatid cohesion
GO:0031397 negative regulation of protein ubiquitination
GO:0031647 regulation of protein stability
GO:0032204 regulation of telomere maintenance
GO:0040029 epigenetic regulation of gene expression
Cellular Component
GO:0000118 histone deacetylase complex
GO:0000228 nuclear chromosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3sfh, PDBe:3sfh, PDBj:3sfh
PDBsum3sfh
PubMed21723733
UniProtQ9BY41|HDAC8_HUMAN Histone deacetylase 8 (Gene Name=HDAC8)

[Back to BioLiP]