Structure of PDB 3scz Chain A

Receptor sequence

>3sczA (length=263) Species: 1773 (Mycobacterium tuberculosis)

PDPDELARRAAQVIADRTGIGEHDVAVVLGSGWLPAVAALGSPTTVLPQA
ELPGFVPPTAAGHAGELLSVPIGAHRVLVLAGRIHAYEGHDLRYVVHPVR
AARAAGAQIMVLTNAAGGLRADLQVGQPVLISDHLNLTARSPLVGGEFVD
LTDAYSPRLRELARQSDPQLAEGVYAGLPGPHYETPAEIRMLQTLGADLV
GMSTVHETIAARAAGAEVLGVSLVTNLAAGITGEPLSHAEVLAAGAASAT
RMGALLADVIARF

3D structure

• PDB: 3scz Combining crystallographic, thermodynamic, and molecular dynamics studies of Mycobacterium tuberculosis purine nucleoside phosphorylase
• Chain: A
• Resolution: 1.95 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): S36 H68 H90 Y92 E93 A120 M207 S208 N231 A233 H243
• Catalytic site (residue number reindexed from 1): S31 H63 H85 Y87 E88 A115 M202 S203 N226 A228 H238
• Enzyme Commision number: 2.4.2.1: purine-nucleoside phosphorylase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HPA	A	G122 Y188 E189 G206 M207 N231	G117 Y183 E184 G201 M202 N226

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0004731 purine-nucleoside phosphorylase activity
• GO:0016757 glycosyltransferase activity
• GO:0016763 pentosyltransferase activity

Biological Process

• GO:0006139 nucleobase-containing compound metabolic process
• GO:0006154 adenosine catabolic process
• GO:0006161 deoxyguanosine catabolic process
• GO:0009116 nucleoside metabolic process

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:3scz, PDBe:3scz, PDBj:3scz
• PDBsum: 3scz
• UniProt: P9WP01|PUNA_MYCTU Purine nucleoside phosphorylase (Gene Name=punA)