Structure of PDB 3s6i Chain A

Receptor sequence
>3s6iA (length=206) Species: 284812 (Schizosaccharomyces pombe 972h-) [Search protein sequence]
TKAEIHLSGLDENWKRLVKLVGNYRPNRSMEKKEPYEELIRAVASQQLHS
KAANAIFNRFKSISNNGQFPTPEEIRDMDFEIMRACGFSARKIDSLKSIA
EATISGLIPTKEEAERLSNEELIERLTQIKGIGRWTVEMLLIFSLNRDDV
MPADDLSIRNGYRYLHRLPKIPTKMYVLKHSEICAPFRTAAAWYLWKTSK
LADYTK
3D structure
PDB3s6i Analysis of substrate specificity of Schizosaccharomyces pombe Mag1 alkylpurine DNA glycosylase.
ChainA
Resolution2.28 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) M154 W211
Catalytic site (residue number reindexed from 1) M139 W196
Enzyme Commision number 3.2.2.21: DNA-3-methyladenine glycosylase II.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A Q61 Q62 L63 H64 K145 G146 G148 W150 T151 D170 L171 S172 Q46 Q47 L48 H49 K130 G131 G133 W135 T136 D155 L156 S157
BS02 dna A Q62 H64 A67 R74 R99 G102 S104 A105 Q47 H49 A52 R59 R84 G87 S89 A90
Gene Ontology
Molecular Function
GO:0003684 damaged DNA binding
GO:0003824 catalytic activity
GO:0003905 alkylbase DNA N-glycosylase activity
GO:0008725 DNA-3-methyladenine glycosylase activity
GO:0016787 hydrolase activity
GO:0032131 alkylated DNA binding
GO:0043916 DNA-7-methylguanine glycosylase activity
GO:0052820 DNA-1,N6-ethenoadenine N-glycosylase activity
GO:0052821 DNA-7-methyladenine glycosylase activity
GO:0052822 DNA-3-methylguanine glycosylase activity
Biological Process
GO:0006281 DNA repair
GO:0006284 base-excision repair
GO:0006285 base-excision repair, AP site formation
GO:0006307 DNA alkylation repair
Cellular Component
GO:0005634 nucleus
GO:0032993 protein-DNA complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3s6i, PDBe:3s6i, PDBj:3s6i
PDBsum3s6i
PubMed21960007
UniProtQ92383|MAG1_SCHPO DNA-3-methyladenine glycosylase 1 (Gene Name=mag1)

[Back to BioLiP]