Structure of PDB 3rvo Chain A |
>3rvoA (length=129) Species: 83333 (Escherichia coli K-12) [Search protein sequence] |
MADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGG YGFVISDWDMPNMDGLELLKTIRADGAMSALPVLMVTAYAKKENIIAAAQ AGASGYVVKPFTAATLEEKLNKIFEKLGM |
|
PDB | 3rvo Probing Mechanistic Similarities between Response Regulator Signaling Proteins and Haloacid Dehalogenase Phosphatases. |
Chain | A |
Resolution | 1.55 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MN |
A |
D13 D57 D59 |
D13 D57 D59 |
|
|
|
|