Structure of PDB 3rvn Chain A

Receptor sequence

>3rvnA (length=130) Species: 83333 (Escherichia coli K-12) [Search protein sequence]

HMADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAG
GYGFVISDWDMPNMDGLELLKTIRADGAMSALPVLMVTAYAKKENIIAAA
QAGASGYVVKPFTAATLEEKLNKIFEKLGM

3D structure

PDB

3rvn Probing Mechanistic Similarities between Response Regulator Signaling Proteins and Haloacid Dehalogenase Phosphatases.

Chain

Resolution

2.25 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MN	A	D13 D57 D59	D14 D58 D60
BS02	BEF	A	D57 W58 D59 T87 A88 K109	D58 W59 D60 T88 A89 K110

Gene Ontology

	Molecular Function
GO:0000156	phosphorelay response regulator activity
GO:0000287	magnesium ion binding
GO:0005515	protein binding
GO:0016407	acetyltransferase activity
GO:0046872	metal ion binding

	Biological Process
GO:0000160	phosphorelay signal transduction system
GO:0006935	chemotaxis
GO:0007165	signal transduction
GO:0009454	aerotaxis
GO:0018393	internal peptidyl-lysine acetylation
GO:0043052	thermotaxis
GO:0050920	regulation of chemotaxis
GO:0071977	bacterial-type flagellum-dependent swimming motility
GO:0097588	archaeal or bacterial-type flagellum-dependent cell motility
GO:1902021	regulation of bacterial-type flagellum-dependent cell motility

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0009288	bacterial-type flagellum
GO:0009433	bacterial-type flagellum basal body, C ring
GO:0120107	bacterial-type flagellum rotor complex

External links

PDB	RCSB:3rvn, PDBe:3rvn, PDBj:3rvn
PDBsum	3rvn
PubMed	25928369
UniProt	P0AE67\|CHEY_ECOLI Chemotaxis protein CheY (Gene Name=cheY)