Structure of PDB 3rno Chain A

Receptor sequence

>3rnoA (length=233) Species: 10090 (Mus musculus)

AVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMS
KSPPTVLVICGPGNNGGDGLVCARHLKLFGYQPTIYYPKRPNKPLFTGLV
TQCQKMDIPFLGEMPPEPMMVDELYELVVDAIFGFSFKGDVREPFHSILS
VLSGLTVPIASIDIPSGWDVEKGNPSGIQPDLLISLTAPKKSATHFTGRY
HYLGGRFVPPALEKKYQLNLPSYPDTECVYRLQ

3D structure

• PDB: 3rno Identification of unknown protein function using metabolite cocktail screening.
• Chain: A
• Resolution: 2.5 Å

Enzymatic activity

• Enzyme Commision number: 5.1.99.6: NAD(P)H-hydrate epimerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAP	A	P87 G88 N89 N90 D93 K114 F158 G159 F160 S161 F162 K163 D165 V166 R167 D188	P62 G63 N64 N65 D68 K89 F133 G134 F135 S136 F137 K138 D140 V141 R142 D163

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0016853 isomerase activity
• GO:0042802 identical protein binding
• GO:0046872 metal ion binding
• GO:0052856 NAD(P)HX epimerase activity

Biological Process

• GO:0002040 sprouting angiogenesis
• GO:0006869 lipid transport
• GO:0010874 regulation of cholesterol efflux
• GO:0016525 negative regulation of angiogenesis
• GO:0031580 membrane raft distribution
• GO:0046496 nicotinamide nucleotide metabolic process
• GO:0110051 metabolite repair

Cellular Component

• GO:0005576 extracellular region
• GO:0005615 extracellular space
• GO:0005634 nucleus
• GO:0005739 mitochondrion
• GO:0005829 cytosol
• GO:0005929 cilium
• GO:0044297 cell body

External links

• PDB: RCSB:3rno, PDBe:3rno, PDBj:3rno
• PDBsum: 3rno
• PubMed: 22940582
• UniProt: Q8K4Z3|NNRE_MOUSE NAD(P)H-hydrate epimerase (Gene Name=Naxe)