Structure of PDB 3rnj Chain A |
>3rnjA (length=67) Species: 9606 (Homo sapiens) [Search protein sequence] |
GPLGSGRMRVKAIFSHAAGDNSTLLSFKEGDLITLLVPEARDGWHYGESE KTKMRGWFPFSYTRVLD |
|
PDB | 3rnj Crystal structure of the SH3 domain from IRSp53 (BAIAP2) |
Chain | A |
Resolution | 1.5 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
EDT |
A |
K380 R433 L435 D436 |
K11 R64 L66 D67 |
|
|
|