Structure of PDB 3rgk Chain A

Receptor sequence
>3rgkA (length=149) Species: 9606 (Homo sapiens) [Search protein sequence]
GLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDRFKHLK
SEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIP
VKYLEFISEAIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKEL
3D structure
PDB3rgk X-ray crystal structure of a recombinant human myoglobin mutant at 2.8 A resolution
ChainA
Resolution1.65 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 1.11.1.-
1.7.-.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEM A K42 F43 R45 H64 V68 L89 S92 H93 H97 I99 Y103 F138 K42 F43 R45 H64 V68 L89 S92 H93 H97 I99 Y103 F138
Gene Ontology
Molecular Function
GO:0004601 peroxidase activity
GO:0005344 oxygen carrier activity
GO:0005515 protein binding
GO:0016491 oxidoreductase activity
GO:0019825 oxygen binding
GO:0020037 heme binding
GO:0046872 metal ion binding
GO:0098809 nitrite reductase activity
Biological Process
GO:0001666 response to hypoxia
GO:0007507 heart development
GO:0015671 oxygen transport
GO:0019430 removal of superoxide radicals
GO:0043353 enucleate erythrocyte differentiation
GO:0050873 brown fat cell differentiation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0016528 sarcoplasm
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3rgk, PDBe:3rgk, PDBj:3rgk
PDBsum3rgk
PubMed2342104
UniProtP02144|MYG_HUMAN Myoglobin (Gene Name=MB)

[Back to BioLiP]