Structure of PDB 3rem Chain A |
>3remA (length=97) Species: 287 (Pseudomonas aeruginosa) [Search protein sequence] |
KTPEDCTGLADIREAIDRIDLDIVQALGRRMDYVKAASRFKASEAAIPAP ERVAAMLPERARWAEENGLDAPFVEGLFAQIIHWYIAEQIKYWRQTR |
|
PDB | 3rem pH Dependence of Catalysis by Pseudomonas aeruginosa Isochorismate-Pyruvate Lyase: Implications for Transition State Stabilization and the Role of Lysine 42. |
Chain | A |
Resolution | 1.95 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
PYR |
A |
A38 K42 |
A37 K41 |
|
|
|
|