Structure of PDB 3r9x Chain A

Receptor sequence

>3r9xA (length=302) Species: 63363 (Aquifex aeolicus)

HMKVGYVAIVGKPNVGKSTLLNNLLGTKVSIISPKAGTTRMRVLGVKNIP
NEAQIIFLDTPGIYEPKKSDVLGHSMVEIAKQSLEEADVILFMIDATEGW
RPRDEEIYQNFIKPLNKPVIVVINKIDKIGPAKNVLPLIDEIHKKHPELT
EIVPISALKGANLDELVKTILKYLPEGEPLFPEDMITDLPLRLLAAEIVR
EKAMMLTREEVPTSIAVKINEIKPGDANPNMLVIKGEIIVDRENLKPIII
GKKGQRLKEIGKRARQELELILGRPVYLELWVKVVPDWRRRPEYVRLFGY
AL

3D structure

• PDB: 3r9x The Era GTPase recognizes the GAUCACCUCC sequence and binds helix 45 near the 3' end of 16S rRNA.
• Chain: A
• Resolution: 2.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A	K66 T206 R207 E208 E209 G224 D225 A226 R241 N243 K245 P246 I247 I249 G250 K251 K252 R255 L256 K257 G260 K261 R264 V275 Y276 L277 W280 V281	K67 T207 R208 E209 E210 G225 D226 A227 R242 N244 K246 P247 I248 I250 G251 K252 K253 R256 L257 K258 G261 K262 R265 V276 Y277 L278 W281 V282
BS02	MG	A	S17 T38	S18 T39
BS03	GNP	A	N13 G15 K16 S17 T18 S32 G36 T37 T38 G61 N123 K124 D126 K127 S155 A156 L157	N14 G16 K17 S18 T19 S33 G37 T38 T39 G62 N124 K125 D127 K128 S156 A157 L158

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003924 GTPase activity
• GO:0005525 GTP binding
• GO:0019843 rRNA binding
• GO:0043024 ribosomal small subunit binding
• GO:0070181 small ribosomal subunit rRNA binding

Biological Process

• GO:0000028 ribosomal small subunit assembly
• GO:0042254 ribosome biogenesis
• GO:0042274 ribosomal small subunit biogenesis

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005886 plasma membrane

External links

• PDB: RCSB:3r9x, PDBe:3r9x, PDBj:3r9x
• PDBsum: 3r9x
• PubMed: 21646538
• UniProt: O67800|ERA_AQUAE GTPase Era (Gene Name=era)