Structure of PDB 3r7w Chain A

Receptor sequence

>3r7wA (length=289) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

PLGSKLLLMGRSGSGKSSMRSIIFSNYSAFDTRRLGATIDVEHSHLRFLG
NMTLNLWDCGGQDVFMENYFTKQKDHIFQMVQVLIHVFDVESTEVLKDIE
IFAKALKQLRKYSPDAKIFVLLHKMDLVQLDKREELFQIMMKNLSETSSE
FGFPNLIGFPTSIWDESLYKAWSQIVCSLIPNMSNHQSNLKKFKEIMNAL
EIILFERTTFLVICSSNLDPKRFEKISNIMKNFKQSCTKLKSGFKTLILN
NNIYVSELSSNMVCFIVLKDMNIPQELVLENIKKAKEFF

3D structure

PDB

3r7w Crystal structure of the Gtr1p-Gtr2p complex reveals new insights into the amino acid-induced TORC1 activation

Chain

Resolution

2.773 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

3.6.5.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GNP	A	S15 G16 G18 K19 S20 S21 T41 H126 K127 D129 S165 I166 W167	S12 G13 G15 K16 S17 S18 T38 H123 K124 D126 S162 I163 W164
BS02	MG	A	S20 T41	S17 T38

Gene Ontology

	Molecular Function
GO:0003924	GTPase activity
GO:0005515	protein binding
GO:0005525	GTP binding
GO:0016787	hydrolase activity
GO:0042802	identical protein binding

	Biological Process
GO:0006360	transcription by RNA polymerase I
GO:0006383	transcription by RNA polymerase III
GO:0006817	phosphate ion transport
GO:0006995	cellular response to nitrogen starvation
GO:0009267	cellular response to starvation
GO:0010507	negative regulation of autophagy
GO:0016237	microautophagy
GO:0031509	subtelomeric heterochromatin formation
GO:0032008	positive regulation of TOR signaling
GO:0032456	endocytic recycling
GO:0034599	cellular response to oxidative stress
GO:0071230	cellular response to amino acid stimulus
GO:1903778	protein localization to vacuolar membrane
GO:1904263	positive regulation of TORC1 signaling

	Cellular Component
GO:0000329	fungal-type vacuole membrane
GO:0000781	chromosome, telomeric region
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005770	late endosome
GO:0005773	vacuole
GO:0005774	vacuolar membrane
GO:0016020	membrane
GO:0031902	late endosome membrane
GO:0071986	Ragulator complex
GO:1990131	Gtr1-Gtr2 GTPase complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3r7w, PDBe:3r7w, PDBj:3r7w
PDBsum	3r7w
PubMed	21816923
UniProt	Q00582\|RAGAB_YEAST GTP-binding protein GTR1 (Gene Name=GTR1)

[Back to BioLiP]