Structure of PDB 3r5u Chain A

Receptor sequence

>3r5uA (length=175) Species: 277988 (Thermococcus thioreducens)

MNPFHELEPGPEVPEVVYALIEIPKGSRNKYELDKKTGLLKLDRVLYSPF
FYPVDYGIIPQTWYDDGDPFDIMVIMREPVYPLTIIEARPIGIMKMEDSG
DKDWKVLAVPVEDPYFNDWKDISDVPKAFLDEIAHFFQRYKELQGKTTKI
EGWGNAEEAKREILRAIEMYKEKFG

3D structure

• PDB: 3r5u The structure of manganese bound Thermococcus thioreducens Inorganic pyrophosphatase
• Chain: A
• Resolution: 1.92 Å

Enzymatic activity

• Enzyme Commision number: 3.6.1.1: inorganic diphosphatase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MN	A	D66 D71 D103	D66 D71 D103

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0004427 inorganic diphosphate phosphatase activity
• GO:0016787 hydrolase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006796 phosphate-containing compound metabolic process

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:3r5u, PDBe:3r5u, PDBj:3r5u
• PDBsum: 3r5u
• UniProt: H0USY5