Structure of PDB 3r2l Chain A

Receptor sequence
>3r2lA (length=154) Species: 287 (Pseudomonas aeruginosa) [Search protein sequence]
MQGHPEVIDYLNTLLTGELAARDQYFIHSRMYEDWGFSKLYERLNHEMEE
ETQHADALLRRILLLEGTPRMRPDDIHPGTTVPEMLEADLKLERHVRAAL
AKGIALCEQHKDFVSRDILKAQLADTEEDHAYWLEQQLGLIARMGLENYL
QSQI
3D structure
PDB3r2l Two distinct ferritin-like molecules in Pseudomonas aeruginosa: the product of the bfrA gene is a bacterial ferritin (FtnA) and not a bacterioferritin (Bfr).
ChainA
Resolution1.85 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 1.16.3.1: ferroxidase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 FE A E18 E51 H54 E18 E51 H54
BS02 FE A E51 E93 H130 E51 E93 H130
BS03 FE A H46 E50 H46 E50
BS04 FE A H46 E47 E50 H130 H46 E47 E50 H130
BS05 FE A E50 D129 H130 E50 D129 H130
Gene Ontology
Molecular Function
GO:0004322 ferroxidase activity
GO:0005506 iron ion binding
GO:0008199 ferric iron binding
GO:0015093 ferrous iron transmembrane transporter activity
GO:0016491 oxidoreductase activity
GO:0020037 heme binding
GO:0046872 metal ion binding
Biological Process
GO:0006826 iron ion transport
GO:0006879 intracellular iron ion homeostasis
GO:0006880 intracellular sequestering of iron ion
GO:0034755 iron ion transmembrane transport
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3r2l, PDBe:3r2l, PDBj:3r2l
PDBsum3r2l
PubMed21574546
UniProtQ9HWF9|BFR_PSEAE Bacterioferritin (Gene Name=bfr)

[Back to BioLiP]