Structure of PDB 3r2c Chain A

Receptor sequence
>3r2cA (length=138) Species: 63363 (Aquifex aeolicus) [Search protein sequence]
MRYRKGARDTAFLVLYRWDLRGENPGELFKEVVEEKNIKNKDAYEYAKKL
VDTAVRHIEEIDSIIEKHLKGWSIDRLGYVERNALRLGVAELIFLKSKEP
GRVFIDIVDLVKKYADEKAGKFVNGVLSAIYKAYITSS
3D structure
PDB3r2c Structural basis for RNA recognition by NusB and NusE in the initiation of transcription antitermination.
ChainA
Resolution1.902 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna A M1 R2 K5 H68 K70 L77 E81 E99 G101 R102 F104 I105 D106 V108 D109 K112 K118 F122 N124 G125 S128 A129 K132 M1 R2 K5 H68 K70 L77 E81 E99 G101 R102 F104 I105 D106 V108 D109 K112 K118 F122 N124 G125 S128 A129 K132
Gene Ontology
Biological Process
GO:0006353 DNA-templated transcription termination
GO:0006355 regulation of DNA-templated transcription
GO:0031564 transcription antitermination
Cellular Component
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3r2c, PDBe:3r2c, PDBj:3r2c
PDBsum3r2c
PubMed21652641
UniProtO66530|NUSB_AQUAE Transcription antitermination protein NusB (Gene Name=nusB)

[Back to BioLiP]