Structure of PDB 3r1b Chain A

Receptor sequence

>3r1bA (length=465) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]

GKLPPGPSPLPVLGNLLQMDRKGLLRSFLRLREKYGDVFTVYLGSRPVVV
LCGTDAIREALVDQAEAFSGRGKIAVVDPIFQGYGVIFANGERWRALRRF
SLATMRDFGMGKRSVEERIQEEARCLVEELRKSKGALLDNTLLFHSITSN
IICSIVFGKRFDYKDPVFLRLLDLFFQSFSLISSFSSQVFELFSGFLKYF
PGTHRQIYRNLQEINTFIGQSVEKHRATLDPSNPRDFIDVYLLRMEKDKS
DPSSEFHHQNLILTVLSLFFAGTETTSTTLRYGFLLMLKYPHVTERVQKE
IEQVIGSHRPPALDDRAKMPYTDAVIHEIQRLGDLIPFGVPHTVTKDTQF
RGYVIPKNTEVFPVLSSALHDPRYFETPNTFNPGHFLDANGALKRNEGFM
PFSLGKRICLGEGIARTELFLFFTTILQNFSIASPVPPEDIDLTPRESGV
GNVPPSYQIRFLARH

3D structure

PDB

3r1b Structural Analysis of Mammalian Cytochrome P450 2B4 Covalently Bound to the Mechanism-Based Inactivator tert-Butylphenylacetylene: Insight into Partial Enzymatic Activity.

Chain

Resolution

3.0 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	T302 F429 C436
Catalytic site (residue number reindexed from 1)	T275 F402 C409
Enzyme Commision number	1.14.14.1: unspecific monooxygenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	GLC	A	D350 H354 L420	D323 H327 L393
BS02	FRU	A	E439 R443	E412 R416
BS03	HEM	A	R98 R125 L295 G299 T302 T303 I363 H369 F429 S430 R434 C436 L437	R71 R98 L268 G272 T275 T276 I336 H342 F402 S403 R407 C409 L410
BS04	TB2	A	A298 T302	A271 T275
BS05	CM5	A	F127 F264 Y268 K274 L288	F100 F237 Y241 K247 L261
BS06	CM5	A	S128 L129 L295 L437	S101 L102 L268 L410

Gene Ontology

	Molecular Function
GO:0004497	monooxygenase activity
GO:0005506	iron ion binding
GO:0008392	arachidonate epoxygenase activity
GO:0016705	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0016712	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen
GO:0020037	heme binding
GO:0046872	metal ion binding
GO:0070330	aromatase activity

	Biological Process
GO:0006805	xenobiotic metabolic process
GO:0019373	epoxygenase P450 pathway

	Cellular Component
GO:0005737	cytoplasm
GO:0005783	endoplasmic reticulum
GO:0005789	endoplasmic reticulum membrane
GO:0016020	membrane
GO:0043231	intracellular membrane-bounded organelle

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3r1b, PDBe:3r1b, PDBj:3r1b
PDBsum	3r1b
PubMed	21510666
UniProt	P00178\|CP2B4_RABIT Cytochrome P450 2B4 (Gene Name=CYP2B4)

[Back to BioLiP]