Structure of PDB 3qz7 Chain A

Receptor sequence

>3qz7A (length=341) Species: 2287 (Saccharolobus solfataricus)

MIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYEA
RKFGVKAGIPIVEAKKILPNAVYLPMRKEVYQQVSSRIMNLLREYSEKIE
IASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKVF
AKIAADMAKPNGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGIN
KLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYNEPIRTRVRKSIGRIVT
MKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGR
TFPHGISKETAYSESVKLLQKILEEDERKIRRIGVRFSKFI

3D structure

• PDB: 3qz7 The y-family DNA polymerase dpo4 uses a template slippage mechanism to create single-base deletions.
• Chain: A
• Resolution: 1.998 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.7: DNA-directed DNA polymerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	S103 E106 K152 P184 G185 G187 I189 T190 K221 S297 R298	S103 E106 K152 P184 G185 G187 I189 T190 K221 S297 R298
BS02	dna	A	V32 Q82 E219 A220 R242 K243 S244 R247 T250 K275 R332	V32 Q82 E219 A220 R242 K243 S244 R247 T250 K275 R332
BS03	DCP	A	D9 Y10 F11 Y12 A44 T45 Y48 R51 A57 D105 K159	D9 Y10 F11 Y12 A44 T45 Y48 R51 A57 D105 K159
BS04	CA	A	D7 F8 D105	D7 F8 D105
BS05	CA	A	D7 D105 E106	D7 D105 E106

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0003677 DNA binding
• GO:0003684 damaged DNA binding
• GO:0003887 DNA-directed DNA polymerase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006260 DNA replication
• GO:0006261 DNA-templated DNA replication
• GO:0006281 DNA repair
• GO:0006974 DNA damage response
• GO:0042276 error-prone translesion synthesis

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:3qz7, PDBe:3qz7, PDBj:3qz7
• PDBsum: 3qz7
• PubMed: 21421759
• UniProt: Q97W02|DPO4_SACS2 DNA polymerase IV (Gene Name=dbh)