Structure of PDB 3qyx Chain A |
>3qyxA (length=131) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence] |
STTFAARLNRLFDTVYPPGRGPHTSAEVIAALKAEGITMSAPYLSQLRSG NRTNPSGATMAALANFFRIKAAYFTDDEYYEKLDKELQWLCTMRDDGVRR IAQRAHGLPSAAQQKVLDRIDELRRAEGIDA |
|
PDB | 3qyx Atypical DNA recognition mechanism used by the EspR virulence regulator of Mycobacterium tuberculosis. |
Chain | A |
Resolution | 3.75 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
dna |
A |
S42 Y45 S58 |
S40 Y43 S56 |
|
|
|
|