Structure of PDB 3qui Chain A

Receptor sequence

>3quiA (length=71) Species: 287 (Pseudomonas aeruginosa)

SKGHSLQDPYLNTLRKERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVS
QMVYKHAISTVVPSRPVRLPS

3D structure

• PDB: 3qui Hfq binds ribonucleotides in three different RNA-binding sites.
• Chain: A
• Resolution: 1.933 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ADP	A	Y25 T61	Y24 T60
BS02	ADP	A	I30 Q52	I29 Q51

Gene Ontology

Molecular Function

• GO:0003723 RNA binding

Biological Process

• GO:0006355 regulation of DNA-templated transcription
• GO:0006417 regulation of translation
• GO:0009372 quorum sensing
• GO:0043487 regulation of RNA stability
• GO:0043609 regulation of carbon utilization
• GO:0045974 regulation of translation, ncRNA-mediated

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:3qui, PDBe:3qui, PDBj:3qui
• PDBsum: 3qui
• PubMed: 23897473
• UniProt: Q9HUM0|HFQ_PSEAE RNA-binding protein Hfq (Gene Name=hfq)