Structure of PDB 3qtt Chain A

Receptor sequence

>3qttA (length=261) Species: 119856 (Francisella tularensis subsp. tularensis)

AMIIADNIKQFHSIRNSLIKQQKIGFVPTMGALHNGHISLIKKAKSENDV
VIVSIFVNPTQFNNPNDYQTYPNQLQQDIQILASLDVDVLFNPSEKDIYP
DGNLLRIEPKLEIANILEGKSRPGHFSGMLTVVLKLLQITKPNNLYLGEK
DYQQVMLIKQLVKDFFINTKIIVCPTQRQPSGLPLSSRNKNLTSTDIEIA
NKIYEILRQDDFSNLEELTNKINSTGAKLQYIQKLNNRIFLAFYIGKVRL
IDNFLKETGPS

3D structure

• PDB: 3qtt Crystal Structure of Pantoate-beta-alanine Ligase from Francisella tularensis Complexed with Beta-gamma ATP and Beta-alanine.
• Chain: A
• Resolution: 2.599 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): M32 H36 H39 Q79 D80 I83 K152 S188 S189 R190
• Catalytic site (residue number reindexed from 1): M30 H34 H37 Q77 D78 I81 K150 S186 S187 R188
• Enzyme Commision number: 6.3.2.1: pantoate--beta-alanine ligase (AMP-forming).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ANP	A	M32 H36 G38 H39 L42 G150 K152 D153 Q179 L187 S188 S189	M30 H34 G36 H37 L40 G148 K150 D151 Q177 L185 S186 S187
BS02	PRO	A	M32 Q63 M131 V135 Q156	M30 Q61 M129 V133 Q154
BS03	MG	A	M32 G33 Y73 S189	M30 G31 Y71 S187
BS04	BAL	A	M32 Q63 R124 D153 R190	M30 Q61 R122 D151 R188

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0004592 pantoate-beta-alanine ligase activity
• GO:0005524 ATP binding
• GO:0016874 ligase activity

Biological Process

• GO:0009058 biosynthetic process
• GO:0015940 pantothenate biosynthetic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:3qtt, PDBe:3qtt, PDBj:3qtt
• PDBsum: 3qtt
• UniProt: Q5NF57|PANC_FRATT Pantothenate synthetase (Gene Name=panC)