Structure of PDB 3qtk Chain A |
>3qtkA (length=96) Species: 9606 (Homo sapiens) [Search protein sequence] |
VVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCND EGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKD |
|
PDB | 3qtk Total chemical synthesis of biologically active vascular endothelial growth factor. |
Chain | A |
Resolution | 1.849 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
TFA |
A |
Q80 G81 Q82 H83 |
Q74 G75 Q76 H77 |
|
|
|
|