Structure of PDB 3qse Chain A

Receptor sequence

>3qseA (length=385) Species: 69000 (Bacillus sp. B-0618)

STHFDVIVVGAGSMGMAAGYQLAKQGVKTLLVDAFDPPHTNGSHHGDTRI
IRHAYGEGREYVPLALRSQELWYELEKETHHKIFTKTGVLVFGPKGESAF
VAETMEAAKEHSLTVDLLEGDEINKRWPGITVPENYNAIFEPNSGVLFSE
NCIRAYRELAEARGAKVLTHTRVEDFDISPDSVKIETANGSYTADKLIVS
MGAWNSKLLSKLNLDIPLQPYRQVVGFFESDESKYSNDIDFPGFMVEVPN
GIYYGFPSFGGCGLKLGYHTFGQKIDPDTINREFGVYPEDESNLRAFLEE
YMPGANGELKRGAVCMYTKTLDEHFIIDLHPEHSNVVIAAGFSGHGFKFS
SGVGEVLSQLALTGKTEHDISIFSINRPALKESLQ

3D structure

• PDB: 3qse Probing oxygen activation sites in two flavoprotein oxidases using chloride as an oxygen surrogate.
• Chain: A
• Resolution: 1.75 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H45 T48 R49 R52 S98 Y254 K265 H269 C315 H345 K348
• Catalytic site (residue number reindexed from 1): H45 T48 R49 R52 S98 Y254 K265 H269 C315 H345 K348
• Enzyme Commision number: 1.5.3.1: sarcosine oxidasee (formaldehyde-forming).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FAD	A	G10 S13 M14 D33 A34 H39 S43 H44 R49 I50 V173 M201 G202 W204 Y254 C315 M316 Y317 G344 H345 G346 F347 K348	G10 S13 M14 D33 A34 H39 S43 H44 R49 I50 V173 M201 G202 W204 Y254 C315 M316 Y317 G344 H345 G346 F347 K348
BS02	CL	A	Y317 F342	Y317 F342
BS03	SAR	A	I50 R52 M245 Y254 H269 G344 H345 K348	I50 R52 M245 Y254 H269 G344 H345 K348	MOAD: Kd>10mM

Gene Ontology

Molecular Function

• GO:0008115 sarcosine oxidase activity
• GO:0016491 oxidoreductase activity
• GO:0050660 flavin adenine dinucleotide binding

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:3qse, PDBe:3qse, PDBj:3qse
• PDBsum: 3qse
• PubMed: 21568312
• UniProt: P40859|MSOX_BACB0 Monomeric sarcosine oxidase (Gene Name=soxA)