Structure of PDB 3qrx Chain A

Receptor sequence
>3qrxA (length=145) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence]
VGLTEEQKQEIREAFDLFDTDGSGTIDAKELKVAMRALGFEPKKEEIKKM
ISEIDKDGSGTIDFEEFLTMMTAKMGERDSREEILKAFRLFDDDNSGTIT
IKDLRRVAKELGENLTEEELQEMIAEADRNDDNEIDEDEFIRIMK
3D structure
PDB3qrx The structure, molecular dynamics, and energetics of centrin-melittin complex.
ChainA
Resolution2.2 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) I30 V126 M163
Catalytic site (residue number reindexed from 1) I11 V107 M144
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A E132 E138 E113 E119
BS02 CA A D38 D40 S42 T44 E49 D19 D21 S23 T25 E30
BS03 CA A D74 D76 S78 T80 E85 D55 D57 S59 T61 E66
BS04 CA A D111 D113 S115 T117 D122 D92 D94 S96 T98 D103
BS05 CA A D147 N149 D151 E153 E158 D128 N130 D132 E134 E139
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0045504 dynein heavy chain binding
GO:0046872 metal ion binding
Biological Process
GO:0051301 cell division
Cellular Component
GO:0036156 inner dynein arm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3qrx, PDBe:3qrx, PDBj:3qrx
PDBsum3qrx
PubMed21989934
UniProtP05434|CATR_CHLRE Caltractin

[Back to BioLiP]