Structure of PDB 3qme Chain A

Receptor sequence

>3qmeA (length=119) Species: 180454 (Anopheles gambiae str. PEST)

ESVIESCSNAVQGAANDELKVHYRANEFPDDPVTHCFVRCIGLELNLYDD
KYGVDLQANWENLGNSDDADEEFVAKHRACLEAKNLETIEDLCERAYSAF
QCLREDYEMYQNNELWSHP

3D structure

• PDB: 3qme Crystal Structures of an Anopheles gambiae Odorant-binding Protein AgamOBP22a and Complexes with Bound Odorants
• Chain: A
• Resolution: 2.002 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CYH	A	L72 Y73 F125 L128	L47 Y48 F100 L103

Gene Ontology

Molecular Function

• GO:0005549 odorant binding

Biological Process

• GO:0007608 sensory perception of smell

Cellular Component

• GO:0005576 extracellular region

External links

• PDB: RCSB:3qme, PDBe:3qme, PDBj:3qme
• PDBsum: 3qme
• UniProt: Q7PGA3