Structure of PDB 3qmc Chain A

Receptor sequence
>3qmcA (length=53) Species: 9606 (Homo sapiens) [Search protein sequence]
SARMCGECEACRRTEDCGHCDFCRDMKKFGGPNKIRQKCRLRQCQLRARE
SYK
3D structure
PDB3qmc The structural basis for selective binding of non-methylated CpG islands by the CFP1 CXXC domain.
ChainA
Resolution2.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A K202 I203 R204 Q205 K34 I35 R36 Q37
BS02 dna A R171 R204 Q205 K206 R210 R217 R3 R36 Q37 K38 R42 R49
BS03 ZN A C173 C176 C179 C212 C5 C8 C11 C44
BS04 ZN A C185 C188 C191 C207 C17 C20 C23 C39
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0008270 zinc ion binding

View graph for
Molecular Function
External links
PDB RCSB:3qmc, PDBe:3qmc, PDBj:3qmc
PDBsum3qmc
PubMed21407193
UniProtQ9P0U4|CXXC1_HUMAN CXXC-type zinc finger protein 1 (Gene Name=CXXC1)

[Back to BioLiP]