Structure of PDB 3qju Chain A

Receptor sequence

>3qjuA (length=552) Species: 300852 (Thermus thermophilus HB8)

VYEAYPEKKATLYFLVLGFLALIVGSLFGPFQALNYGNVDAYPLLKRLLP
FVQSYYQGLTLHGVLNAIVFTQLFAQAIMVYLPARELNMRPNMGLMWLSW
WMAFIGLVVAALPLLANEATVLYTFYPPLKGHWAFYLGASVFVLSTWVSI
YIVLDLWRRWKAANPGKVTPLVTYMAVVFWLMWFLASLGLVLEAVLFLLP
WSFGLVEGVDPLVARTLFWWTGHPIVYFWLLPAYAIIYTILPKQAGGKLV
SDPMARLAFLLFLLLSTPVGFHHQFADPGIDPTWKMIHSVLTLFVAVPSL
MTAFTVAASLEFAGRLRGGRGLFGWIRALPWDNPAFVAPVLGLLGFIPGG
AGGIVNASFTLDYVVHNTAWVPGHFHLQVASLVTLTAMGSLYWLLPNLTG
KPISDAQRRLGLAVVWLWFLGMMIMAVGLHWAGLLNVPRRAYIAQVPDAY
PHAAVPMVFNVLAGIVLLVALLLFIYGLFSVLLSRERKPELAEAPLPFAE
VISGPEDRRLVLAMDRIGFWFAVAAILVVLAYGPTLVQLFGHLNPVPGWR
LW

3D structure

• PDB: 3qju Structural changes that occur upon photolysis of the Fe(II)(a3)-CO complex in the cytochrome ba(3)-oxidase of Thermus thermophilus: A combined X-ray crystallographic and infrared spectral study demonstrates CO binding to Cu(B).
• Chain: A
• Resolution: 2.9 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H72 P101 Y133 S155 T156 H233 I235 Y237 Y248 H282 H283 S309 G331 H384 F385 H386 R449 R450
• Catalytic site (residue number reindexed from 1): H62 P91 Y123 S145 T146 H223 I225 Y227 Y238 H272 H273 S299 G321 H374 F375 H376 R439 R440
• Enzyme Commision number: 7.1.1.9: cytochrome-c oxidase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CU1	A	H233 H282 H283	H223 H272 H273
BS02	HEM	A	G39 P40 Q42 A43 Y46 Y65 L69 H72 N76 A77 L132 Y133 F385 H386 A390 M435 R450	G29 P30 Q32 A33 Y36 Y55 L59 H62 N66 A67 L122 Y123 F375 H376 A380 M425 R440
BS03	HAS	A	Y133 W229 V236 Y237 W239 H282 S309 L310 A313 L353 F356 G363 N366 A367 D372 H376 V381 H384 F385 Q388 V389 R449	Y123 W219 V226 Y227 W229 H272 S299 L300 A303 L343 F346 G353 N356 A357 D362 H366 V371 H374 F375 Q378 V379 R439

Gene Ontology

Molecular Function

• GO:0004129 cytochrome-c oxidase activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006119 oxidative phosphorylation
• GO:0009060 aerobic respiration
• GO:1902600 proton transmembrane transport

Cellular Component

• GO:0005886 plasma membrane
• GO:0016020 membrane

External links

• PDB: RCSB:3qju, PDBe:3qju, PDBj:3qju
• PDBsum: 3qju
• PubMed: 22226917
• UniProt: Q5SJ79|COX1_THET8 Cytochrome c oxidase subunit 1 (Gene Name=cbaA)