Structure of PDB 3qjt Chain A

Receptor sequence

>3qjtA (length=557) Species: 300852 (Thermus thermophilus HB8)

SEISRVYEAYPEKKATLYFLVLGFLALIVGSLFGPFQALNYGNVDAYPLL
KRLLPFVQSYYQGLTLHGVLNAIVFTQLFAQAIMVYLPARELNMRPNMGL
MWLSWWMAFIGLVVAALPLLANEATVLYTFYPPLKGHWAFYLGASVFVLS
TWVSIYIVLDLWRRWKAANPGKVTPLVTYMAVVFWLMWFLASLGLVLEAV
LFLLPWSFGLVEGVDPLVARTLFWWTGHPIVYFWLLPAYAIIYTILPKQA
GGRLVSDPMARLAFLLFLLLSTPVGFHHQFADPGIDPTWKMIHSVLTLFV
AVPSLMTAFTVAASLEFAGRLRGGRGLFGWIRALPWDNPAFVAPVLGLLG
FIPGGAGGIVNASFTLDYVVHNTAWVPGHFHLQVASLVTLTAMGSLYWLL
PNLTGKPISDAQRRLGLAVVWLWFLGMMIMAVGLHWAGLLNVPRRAYIAQ
VPDAYPHAAVPMVFNVLAGIVLLVALLLFIYGLFSVLLSRERKPELAEAP
LPFAEVISGPEDRRLVLAMDRIGFWFAVAAILVVLAYGPTLVQLFGHLNP
VPGWRLW

3D structure

• PDB: 3qjt Structural changes that occur upon photolysis of the Fe(II)(a3)-CO complex in the cytochrome ba(3)-oxidase of Thermus thermophilus: A combined X-ray crystallographic and infrared spectral study demonstrates CO binding to Cu(B).
• Chain: A
• Resolution: 2.95 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H72 P101 Y133 S155 T156 H233 I235 Y237 Y248 H282 H283 S309 G331 H384 F385 H386 R449 R450
• Catalytic site (residue number reindexed from 1): H67 P96 Y128 S150 T151 H228 I230 Y232 Y243 H277 H278 S304 G326 H379 F380 H381 R444 R445
• Enzyme Commision number: 7.1.1.9: cytochrome-c oxidase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CU1	A	H233 H282 H283	H228 H277 H278
BS02	HEM	A	G39 P40 Q42 Y46 Y65 L69 H72 N76 Y133 F385 H386 V389 A390 W428 M432 M435 R449 R450 L477	G34 P35 Q37 Y41 Y60 L64 H67 N71 Y128 F380 H381 V384 A385 W423 M427 M430 R444 R445 L472
BS03	HAS	A	Y133 V236 Y237 W239 L240 H282 S309 L310 A313 A317 L320 L353 F356 G363 N366 A367 D372 H376 V381 H384 F385 Q388 V389 R449	Y128 V231 Y232 W234 L235 H277 S304 L305 A308 A312 L315 L348 F351 G358 N361 A362 D367 H371 V376 H379 F380 Q383 V384 R444

Gene Ontology

Molecular Function

• GO:0004129 cytochrome-c oxidase activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006119 oxidative phosphorylation
• GO:0009060 aerobic respiration
• GO:1902600 proton transmembrane transport

Cellular Component

• GO:0005886 plasma membrane
• GO:0016020 membrane

External links

• PDB: RCSB:3qjt, PDBe:3qjt, PDBj:3qjt
• PDBsum: 3qjt
• PubMed: 22226917
• UniProt: Q5SJ79|COX1_THET8 Cytochrome c oxidase subunit 1 (Gene Name=cbaA)