Structure of PDB 3qih Chain A

Receptor sequence

>3qihA (length=99) Species: 11686 (Human immunodeficiency virus type 1 (BRU ISOLATE))

PQITLWKRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGI
GGFIKVRQYDQIIIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

3D structure

• PDB: 3qih Novel inhibitors for HIV-1 protease
• Chain: A
• Resolution: 1.39 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D25 T26 G27
• Catalytic site (residue number reindexed from 1): D25 T26 G27
• Enzyme Commision number: 2.7.7.-
  2.7.7.49: RNA-directed DNA polymerase.
  2.7.7.7: DNA-directed DNA polymerase.
  3.1.-.-
  3.1.13.2: exoribonuclease H.
  3.1.26.13: retroviral ribonuclease H.
  3.4.23.16: HIV-1 retropepsin.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FG7	A	R8 P81 V82 I84	R8 P81 V82 I84
BS02	NI7	A	D25 G27 A28 D30 I50	D25 G27 A28 D30 I50
BS03	FG7	A	G27 G48 G49	G27 G48 G49

Gene Ontology

Molecular Function

• GO:0004190 aspartic-type endopeptidase activity

Biological Process

• GO:0006508 proteolysis

External links

• PDB: RCSB:3qih, PDBe:3qih, PDBj:3qih
• PDBsum: 3qih
• UniProt: P03367|POL_HV1BR Gag-Pol polyprotein (Gene Name=gag-pol)