Structure of PDB 3qi2 Chain A

Receptor sequence

>3qi2A (length=318) Species: 9606 (Homo sapiens) [Search protein sequence]

GAREVKLLLLGARESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQ
SIIAIIRAMGRLKIDFGDSARADDARQLFVLAGAAEEGFMTAELAGVIKR
LWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRV
KTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSD
YDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIK
KSPLTICYPEYAGSNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDT
KNVQFVFDAVTDVIIKNN

3D structure

PDB

3qi2 A P-loop Mutation in Galpha Subunits Prevents Transition to the Active State: Implications for G-protein Signaling in Fungal Pathogenesis

Chain

Resolution

2.797 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	E43 T48 R178 D200 Q204
Catalytic site (residue number reindexed from 1)	E14 T19 R149 D171 Q175
Enzyme Commision number	3.6.5.1: heterotrimeric G-protein GTPase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GDP	A	R42 E43 S44 G45 K46 S47 T48 S151 R176 R178 N269 K270 D272 L273 C325 A326 T327	R13 E14 S15 G16 K17 S18 T19 S122 R147 R149 N240 K241 D243 L244 C296 A297 T298

Gene Ontology

	Molecular Function
GO:0000287	magnesium ion binding
GO:0001664	G protein-coupled receptor binding
GO:0003924	GTPase activity
GO:0003925	G protein activity
GO:0005515	protein binding
GO:0005525	GTP binding
GO:0010854	adenylate cyclase regulator activity
GO:0016787	hydrolase activity
GO:0019001	guanyl nucleotide binding
GO:0019003	GDP binding
GO:0031683	G-protein beta/gamma-subunit complex binding
GO:0031749	D2 dopamine receptor binding
GO:0031821	G protein-coupled serotonin receptor binding
GO:0046872	metal ion binding

	Biological Process
GO:0007165	signal transduction
GO:0007186	G protein-coupled receptor signaling pathway
GO:0007188	adenylate cyclase-modulating G protein-coupled receptor signaling pathway
GO:0007193	adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway
GO:0007198	adenylate cyclase-inhibiting serotonin receptor signaling pathway
GO:0034695	response to prostaglandin E
GO:0043434	response to peptide hormone
GO:0043949	regulation of cAMP-mediated signaling
GO:0045542	positive regulation of cholesterol biosynthetic process
GO:0051301	cell division
GO:0060236	regulation of mitotic spindle organization
GO:0072678	T cell migration
GO:1904322	cellular response to forskolin
GO:1904778	positive regulation of protein localization to cell cortex

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005765	lysosomal membrane
GO:0005813	centrosome
GO:0005829	cytosol
GO:0005834	heterotrimeric G-protein complex
GO:0005856	cytoskeleton
GO:0005886	plasma membrane
GO:0005938	cell cortex
GO:0030496	midbody
GO:0070062	extracellular exosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3qi2, PDBe:3qi2, PDBj:3qi2
PDBsum	3qi2
PubMed	22383884
UniProt	P63096\|GNAI1_HUMAN Guanine nucleotide-binding protein G(i) subunit alpha-1 (Gene Name=GNAI1)

[Back to BioLiP]