Structure of PDB 3qc3 Chain A

Receptor sequence

>3qc3A (length=225) Species: 9606 (Homo sapiens)

GMASGCKIGPSILNSDLANLGAECLRMLDSGADYLHLDVMDGHFVPNITF
GHPVVESLRKQLGQDPFFDMHMMVSKPEQWVKPMAVAGANQYTFHLEATE
NPGALIKDIRENGMKVGLAIKPGTSVEYLAPWANQIDMALVMTVEPGFGG
QKFMEDMMPKVHWLRTQFPSLDIEVDGGVGPDTVHKCAEAGANMIVSGSA
IMRSEDPRSVINLLRNVCSEAAQKR

3D structure

• PDB: 3qc3 Crystal structure of a D-ribulose-5-phosphate-3-epimerase (NP_954699) from HOMO SAPIENS at 2.20 A resolution
• Chain: A
• Resolution: 2.2 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): S10 H35 D37 M39 H70 M72 M141 D175
• Catalytic site (residue number reindexed from 1): S11 H36 D38 M40 H71 M73 M142 D176
• Enzyme Commision number: 5.1.3.1: ribulose-phosphate 3-epimerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	A	H35 D37 H70 D175	H36 D38 H71 D176
BS02	FE	A	H35 D37 H70 D175	H36 D38 H71 D176

Gene Ontology

Molecular Function

• GO:0004750 D-ribulose-phosphate 3-epimerase activity
• GO:0005515 protein binding
• GO:0016853 isomerase activity
• GO:0016857 racemase and epimerase activity, acting on carbohydrates and derivatives
• GO:0042802 identical protein binding
• GO:0042803 protein homodimerization activity
• GO:0046872 metal ion binding

Biological Process

• GO:0005975 carbohydrate metabolic process
• GO:0006098 pentose-phosphate shunt
• GO:0009052 pentose-phosphate shunt, non-oxidative branch

Cellular Component

• GO:0005829 cytosol
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:3qc3, PDBe:3qc3, PDBj:3qc3
• PDBsum: 3qc3
• UniProt: Q96AT9|RPE_HUMAN Ribulose-phosphate 3-epimerase (Gene Name=RPE)