Structure of PDB 3pw7 Chain A

Receptor sequence

>3pw7A (length=343) Species: 2287 (Saccharolobus solfataricus)

HHMIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANY
EARKFGVKAGIPIVEAKKILPNAVYLPMRKEVYQQVSSRIMNLLREYSEK
IEIASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNK
VFAKIAADMAKPNGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLG
INKLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYNEPIRTRVRKSIGRI
VTMKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSR
GRTFPHGISKETAYSESVKLLQKILEEDERKIRRIGVRFSKFI

3D structure

• PDB: 3pw7 Bypass of Aflatoxin B(1) Adducts by the Sulfolobus solfataricus DNA Polymerase IV.
• Chain: A
• Resolution: 2.9 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.7: DNA-directed DNA polymerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	F36 S37 R39 F40 S43 G44 A45 G221 E222 A223 R245 K246 S247 I248 G249 R250 I251 T253 L296 R334 R335 R339	F35 S36 R38 F39 S42 G43 A44 G220 E221 A222 R244 K245 S246 I247 G248 R249 I250 T252 L295 R333 R334 R338
BS02	dna	A	G188 G190 I192 T193 S300 R301 G302 T304	G187 G189 I191 T192 S299 R300 G301 T303
BS03	DCP	A	D10 F11 Y13 D108 E109	D9 F10 Y12 D107 E108
BS04	CA	A	Y51 R54 K162	Y50 R53 K161
BS05	AFN	A	Y15 V46 A47 A60 M79	Y14 V45 A46 A59 M78

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0003677 DNA binding
• GO:0003684 damaged DNA binding
• GO:0003887 DNA-directed DNA polymerase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006260 DNA replication
• GO:0006261 DNA-templated DNA replication
• GO:0006281 DNA repair
• GO:0006974 DNA damage response
• GO:0042276 error-prone translesion synthesis

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:3pw7, PDBe:3pw7, PDBj:3pw7
• PDBsum: 3pw7
• PubMed: 21790157
• UniProt: Q97W02|DPO4_SACS2 DNA polymerase IV (Gene Name=dbh)