Structure of PDB 3pw5 Chain A

Receptor sequence

>3pw5A (length=342) Species: 2287 (Saccharolobus solfataricus)

HMIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYE
ARKFGVKAGIPIVEAKKILPNAVYLPMRKEVYQQVSSRIMNLLREYSEKI
EIASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKV
FAKIAADMAKPNGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGI
NKLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYNEPIRTRVRKSIGRIV
TMKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRG
RTFPHGISKETAYSESVKLLQKILEEDERKIRRIGVRFSKFI

3D structure

• PDB: 3pw5 Bypass of Aflatoxin B(1) Adducts by the Sulfolobus solfataricus DNA Polymerase IV.
• Chain: A
• Resolution: 3.0 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.7: DNA-directed DNA polymerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	V33 M77 G219 A221 R243 K244 S245 I246 G247 R248 I249 V250 T251 R337	V33 M77 G219 A221 R243 K244 S245 I246 G247 R248 I249 V250 T251 R337
BS02	dna	A	G186 G188 I190 T191 S298 R299 T302	G186 G188 I190 T191 S298 R299 T302
BS03	TTP	A	D10 Y11 F12 Y13 A45 Y49 R52 D106	D10 Y11 F12 Y13 A45 Y49 R52 D106
BS04	CA	A	D8 F9 D106	D8 F9 D106
BS05	CA	A	D8 D106 E107	D8 D106 E107
BS06	CA	A	A182 I187	A182 I187

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0003677 DNA binding
• GO:0003684 damaged DNA binding
• GO:0003887 DNA-directed DNA polymerase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006260 DNA replication
• GO:0006261 DNA-templated DNA replication
• GO:0006281 DNA repair
• GO:0006974 DNA damage response
• GO:0042276 error-prone translesion synthesis

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:3pw5, PDBe:3pw5, PDBj:3pw5
• PDBsum: 3pw5
• PubMed: 21790157
• UniProt: Q97W02|DPO4_SACS2 DNA polymerase IV (Gene Name=dbh)