Structure of PDB 3pw0 Chain A

Receptor sequence

>3pw0A (length=341) Species: 2287 (Saccharolobus solfataricus)

MIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYEA
RKFGVKAGIPIVEAKKILPNAVYLPMRKEVYQQVSSRIMNLLREYSEKIE
IASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKVF
AKIAADMAKPNGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGIN
KLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYNEPIRTRVRKSIGRIVT
MKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGR
TFPHGISKETAYSESVKLLQKILEEDERKIRRIGVRFSKFI

3D structure

• PDB: 3pw0 Bypass of Aflatoxin B(1) Adducts by the Sulfolobus solfataricus DNA Polymerase IV.
• Chain: A
• Resolution: 2.91 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.7: DNA-directed DNA polymerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	V32 A42 G58 K243 S244 G246 R247 I248 T250 I295 R331 R332 R336	V32 A42 G58 K243 S244 G246 R247 I248 T250 I295 R331 R332 R336
BS02	dna	A	G185 G187 I189 T190 K193 S297 R298 G299 T301	G185 G187 I189 T190 K193 S297 R298 G299 T301
BS03	DTP	A	F8 Y10 Y12 A44 Y48 R51 A57 D105 K159	F8 Y10 Y12 A44 Y48 R51 A57 D105 K159
BS04	CA	A	D7 F8 D105	D7 F8 D105
BS05	CA	A	A181 D182	A181 D182

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0003677 DNA binding
• GO:0003684 damaged DNA binding
• GO:0003887 DNA-directed DNA polymerase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006260 DNA replication
• GO:0006261 DNA-templated DNA replication
• GO:0006281 DNA repair
• GO:0006974 DNA damage response
• GO:0042276 error-prone translesion synthesis

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:3pw0, PDBe:3pw0, PDBj:3pw0
• PDBsum: 3pw0
• PubMed: 21790157
• UniProt: Q97W02|DPO4_SACS2 DNA polymerase IV (Gene Name=dbh)