Structure of PDB 3puj Chain A

Receptor sequence
>3pujA (length=533) Species: 10116 (Rattus norvegicus) [Search protein sequence]
PIGLKAVVGEKIMHDVIKKVKKKGEWKVLVVDQLSMRMLSSCCKMTDIMT
EGITIVEDINKRREPLPSLEAVYLITPSEKSVHSLISDFKDPPTAKYRAA
HVFFTDSCPDALFNELVKSRAAKVIKTLTEINIAFLPYESQVYSLDSADS
FQSFYSPHKAQMKNPILERLAEQIATLCATLKEYPAVRYRGEYKDNALLA
QLIQDKLDAYKADDPTMGEGPDKARSQLLILDRGFDPSSPVLHELTFQAM
SYDLLPIENDVYKYETVKEVLLDEDDDLWIALRHKHIAEVSQEVTRSLKD
FSSSKMRDLSQMLKKMPQYQKELSKYSTHLHLAEDCMKHYQGTVDKLCRV
EQDLAMGTDAEGEKIKDPMRAIVPILLDANVSTYDKIRIILLYIFLKNGI
TEENLNKLIQHAQIPPEDSEIITNMAHLGVPIVTRKERISEQTYQLSRWT
PIIKDIMEDTIEDKLDTKHYPYISRSGPRLIIFILGGVSLNEMRCAYEVT
QANGKWEVLIGSTHILTPQKLLDTLKKLNKTDE
3D structure
PDB3puj Possible roles for Munc18-1 domain 3a and Syntaxin1 N-peptide and C-terminal anchor in SNARE complex formation
ChainA
Resolution3.313 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A F115 V119 I127 T129 L130 T131 E132 I133 F113 V117 I125 T127 L128 T129 E130 I131
Gene Ontology
Molecular Function
GO:0000149 SNARE binding
GO:0005515 protein binding
GO:0017075 syntaxin-1 binding
GO:0019901 protein kinase binding
GO:0019904 protein domain specific binding
GO:0019905 syntaxin binding
GO:0042802 identical protein binding
GO:0043274 phospholipase binding
GO:0060090 molecular adaptor activity
Biological Process
GO:0002576 platelet degranulation
GO:0003006 developmental process involved in reproduction
GO:0006886 intracellular protein transport
GO:0006887 exocytosis
GO:0006904 vesicle docking involved in exocytosis
GO:0007269 neurotransmitter secretion
GO:0007274 neuromuscular synaptic transmission
GO:0007412 axon target recognition
GO:0010807 regulation of synaptic vesicle priming
GO:0015031 protein transport
GO:0016082 synaptic vesicle priming
GO:0016188 synaptic vesicle maturation
GO:0016192 vesicle-mediated transport
GO:0031333 negative regulation of protein-containing complex assembly
GO:0031338 regulation of vesicle fusion
GO:0032229 negative regulation of synaptic transmission, GABAergic
GO:0032355 response to estradiol
GO:0035493 SNARE complex assembly
GO:0035544 negative regulation of SNARE complex assembly
GO:0043306 positive regulation of mast cell degranulation
GO:0043524 negative regulation of neuron apoptotic process
GO:0045921 positive regulation of exocytosis
GO:0045956 positive regulation of calcium ion-dependent exocytosis
GO:0050821 protein stabilization
GO:0051402 neuron apoptotic process
GO:0051649 establishment of localization in cell
GO:0060292 long-term synaptic depression
GO:0070527 platelet aggregation
GO:0071346 cellular response to type II interferon
GO:0072659 protein localization to plasma membrane
GO:0099525 presynaptic dense core vesicle exocytosis
GO:0106022 positive regulation of vesicle docking
GO:1903296 positive regulation of glutamate secretion, neurotransmission
GO:2000367 regulation of acrosomal vesicle exocytosis
Cellular Component
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0030141 secretory granule
GO:0030424 axon
GO:0031091 platelet alpha granule
GO:0032991 protein-containing complex
GO:0043195 terminal bouton
GO:0045335 phagocytic vesicle
GO:0048471 perinuclear region of cytoplasm
GO:0048787 presynaptic active zone membrane
GO:0098688 parallel fiber to Purkinje cell synapse
GO:0098793 presynapse
GO:0098794 postsynapse
GO:0098831 presynaptic active zone cytoplasmic component
GO:0098888 extrinsic component of presynaptic membrane
GO:0098978 glutamatergic synapse
GO:0099523 presynaptic cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3puj, PDBe:3puj, PDBj:3puj
PDBsum3puj
PubMed21193638
UniProtP61765|STXB1_RAT Syntaxin-binding protein 1 (Gene Name=Stxbp1)

[Back to BioLiP]