Structure of PDB 3ps5 Chain A

Receptor sequence
>3ps5A (length=529) Species: 9606 (Homo sapiens) [Search protein sequence]
MVRWFHRDLSGLDAETLLKGRGVHGSFLARPSRKNQGDFSLSVRVGDQVT
HIRIQNSGDFYDLYGGEKFATLTELVEYYTQQQGVLQDRDGTIIHLKYPL
NCSDPTSERWYHGHMSGGQAETLLQAKGEPWTFLVRESLSQPGDFVLSVL
SDQPKAGPGSPLRVTHIKVMCEGGRYTVGGLETFDSLTDLVEHFKKTGIE
EASGAFVYLRQPYYATRVNAADIENRVLELNKKQESEDTAKAGFWEEFES
LQKQEVKNLHQRLEGQRPENKGKNRYKNILPFDHSRVILQGRDSNIPGSD
YINANYIKNQLLGPDENAKTYIASQGCLEATVNDFWQMAWQENSRVIVMT
TREVEKGRNKCVPYWPEVGMQRAYGPYSVTNCGEHDTTEYKLRTLQVSPL
DNGDLIREIWHYQYLSWPDHGVPSEPGGVLSFLDQINQRQESLPHAGPII
VHSSAGIGRTGTIIVIDMLMENISTKGLDCDIDIQKTIQMVRAQRSGMVQ
TEAQYKFIYVAIAQFIETTKKKLEVLQSQ
3D structure
PDB3ps5 Crystal structure of human protein tyrosine phosphatase SHP-1 in the open conformation.
ChainA
Resolution3.1 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) D419 S453 R459 T460 Q500
Catalytic site (residue number reindexed from 1) D419 S453 R459 T460 Q500
Enzyme Commision number 3.1.3.48: protein-tyrosine-phosphatase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 SO4 A R136 S138 L139 S140 R136 S138 L139 S140
BS02 SO4 A R21 K520 R21 K520
BS03 SO4 A S107 E108 T188 S107 E108 T188
BS04 SO4 A S453 A455 I457 G458 R459 S453 A455 I457 G458 R459
BS05 SO4 A R30 S32 R33 K34 R30 S32 R33 K34
Gene Ontology
Molecular Function
GO:0001784 phosphotyrosine residue binding
GO:0004721 phosphoprotein phosphatase activity
GO:0004725 protein tyrosine phosphatase activity
GO:0004726 non-membrane spanning protein tyrosine phosphatase activity
GO:0005001 transmembrane receptor protein tyrosine phosphatase activity
GO:0005515 protein binding
GO:0017124 SH3 domain binding
GO:0019901 protein kinase binding
GO:0042169 SH2 domain binding
GO:0050839 cell adhesion molecule binding
GO:0140031 phosphorylation-dependent protein binding
Biological Process
GO:0000165 MAPK cascade
GO:0000278 mitotic cell cycle
GO:0002244 hematopoietic progenitor cell differentiation
GO:0002924 negative regulation of humoral immune response mediated by circulating immunoglobulin
GO:0006470 protein dephosphorylation
GO:0007186 G protein-coupled receptor signaling pathway
GO:0008284 positive regulation of cell population proliferation
GO:0008285 negative regulation of cell population proliferation
GO:0016311 dephosphorylation
GO:0016525 negative regulation of angiogenesis
GO:0018108 peptidyl-tyrosine phosphorylation
GO:0019221 cytokine-mediated signaling pathway
GO:0030154 cell differentiation
GO:0030220 platelet formation
GO:0031295 T cell costimulation
GO:0032715 negative regulation of interleukin-6 production
GO:0032720 negative regulation of tumor necrosis factor production
GO:0033007 negative regulation of mast cell activation involved in immune response
GO:0033630 positive regulation of cell adhesion mediated by integrin
GO:0035335 peptidyl-tyrosine dephosphorylation
GO:0035556 intracellular signal transduction
GO:0035855 megakaryocyte development
GO:0042098 T cell proliferation
GO:0042110 T cell activation
GO:0042130 negative regulation of T cell proliferation
GO:0042267 natural killer cell mediated cytotoxicity
GO:0042981 regulation of apoptotic process
GO:0043409 negative regulation of MAPK cascade
GO:0045577 regulation of B cell differentiation
GO:0045824 negative regulation of innate immune response
GO:0050732 negative regulation of peptidyl-tyrosine phosphorylation
GO:0050852 T cell receptor signaling pathway
GO:0050853 B cell receptor signaling pathway
GO:0050859 negative regulation of B cell receptor signaling pathway
GO:0050860 negative regulation of T cell receptor signaling pathway
GO:0051279 regulation of release of sequestered calcium ion into cytosol
GO:0051897 positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction
GO:0060338 regulation of type I interferon-mediated signaling pathway
GO:0070372 regulation of ERK1 and ERK2 cascade
GO:0070527 platelet aggregation
GO:0106015 negative regulation of inflammatory response to wounding
GO:0160162 CD27 signaling pathway
GO:1905867 epididymis development
GO:2000045 regulation of G1/S transition of mitotic cell cycle
Cellular Component
GO:0005576 extracellular region
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0005911 cell-cell junction
GO:0016020 membrane
GO:0032991 protein-containing complex
GO:0035580 specific granule lumen
GO:0042105 alpha-beta T cell receptor complex
GO:0070062 extracellular exosome
GO:1904724 tertiary granule lumen

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3ps5, PDBe:3ps5, PDBj:3ps5
PDBsum3ps5
PubMed21465528
UniProtP29350|PTN6_HUMAN Tyrosine-protein phosphatase non-receptor type 6 (Gene Name=PTPN6)

[Back to BioLiP]