Structure of PDB 3pqh Chain A |
>3pqhA (length=107) Species: 38018 (Bacteriophage sp.) [Search protein sequence] |
EKVIISNNKQTYASFDPNGNISVYNTQGMKIDMTPNSIVLTDAGGGKLTL QGGTMTYKGGTVNLNGLTITPDGRMTDSGGIGLHTHTHPVRGVETGGSTV TSDKPNG |
|
PDB | 3pqh Phage pierces the host cell membrane with the iron-loaded spike. |
Chain | A |
Resolution | 1.295 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
FE |
A |
H223 H225 |
H86 H88 |
|
|
|