Structure of PDB 3pp5 Chain A

Receptor sequence
>3pp5A (length=63) Species: 44689 (Dictyostelium discoideum) [Search protein sequence]
TKTNIQKDWEQREFIEDMSINIQKIVEFLNKFELSTRNKLSDLNEKLTIL
DRQVDYLEATFKT
3D structure
PDB3pp5 High-resolution X-ray structure of the trimeric Scar/WAVE-complex precursor Brk1.
ChainA
Resolution1.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CA A E15 E18 E13 E16
BS02 CA A E15 E18 E13 E16
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0042802 identical protein binding
GO:0044877 protein-containing complex binding
GO:0060090 molecular adaptor activity
Biological Process
GO:0000281 mitotic cytokinesis
GO:0007015 actin filament organization
GO:0008064 regulation of actin polymerization or depolymerization
GO:0031269 pseudopodium assembly
GO:0046847 filopodium assembly
GO:0048870 cell motility
Cellular Component
GO:0005737 cytoplasm
GO:0005856 cytoskeleton
GO:0005911 cell-cell junction
GO:0031143 pseudopodium
GO:0031209 SCAR complex
GO:0031252 cell leading edge
GO:0032433 filopodium tip
GO:0060187 cell pole

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3pp5, PDBe:3pp5, PDBj:3pp5
PDBsum3pp5
PubMed21701600
UniProtQ54X65|BRK1_DICDI Protein BRICK1 (Gene Name=brk1)

[Back to BioLiP]