Structure of PDB 3pp5 Chain A |
>3pp5A (length=63) Species: 44689 (Dictyostelium discoideum) [Search protein sequence] |
TKTNIQKDWEQREFIEDMSINIQKIVEFLNKFELSTRNKLSDLNEKLTIL DRQVDYLEATFKT |
|
PDB | 3pp5 High-resolution X-ray structure of the trimeric Scar/WAVE-complex precursor Brk1. |
Chain | A |
Resolution | 1.5 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
A |
E15 E18 |
E13 E16 |
|
BS02 |
CA |
A |
E15 E18 |
E13 E16 |
|
|
|
|