Structure of PDB 3plu Chain A

Receptor sequence

>3pluA (length=74) Species: 4932 (Saccharomyces cerevisiae)

HMIEVVVNDRLGKKVRVKCLGEDSVGDFKKVLSLQIGTQPNKIVLQKGGS
VLKDHISLEDYEVHDQTNLELYYL

3D structure

• PDB: 3plu Role of the ubiquitin-like protein Hub1 in splice-site usage and alternative splicing.
• Chain: A
• Resolution: 1.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	M1 K17 D22 D26 K29 V30 L33	M2 K18 D23 D27 K30 V31 L34

Gene Ontology

Molecular Function

• GO:0031386 protein tag activity

Biological Process

• GO:0000398 mRNA splicing, via spliceosome
• GO:0000753 cell morphogenesis involved in conjugation with cellular fusion
• GO:0033120 positive regulation of RNA splicing
• GO:0036211 protein modification process
• GO:0043687 post-translational protein modification

Cellular Component

• GO:0005575 cellular_component
• GO:0005634 nucleus
• GO:0005737 cytoplasm

External links

• PDB: RCSB:3plu, PDBe:3plu, PDBj:3plu
• PDBsum: 3plu
• PubMed: 21614000
• UniProt: Q6Q546|HUB1_YEAST Ubiquitin-like modifier HUB1 (Gene Name=HUB1)