Structure of PDB 3pl9 Chain A

Receptor sequence

>3pl9A (length=156) Species: 3562 (Spinacia oleracea) [Search protein sequence]

GLQRFRECELIHGRWAMLATLGALTVEGLTGITWQDAGKVELIEGSSYLG
QPLPFSMTTLIWIEVLVIGYIEFQRNAELDTEKRLYPGGTFDPLGLASDP
EKKPILQLAEIKHARLAMVGFLGFAVQAAVTGKGPLNNWVTHLSDPLHTT
ILDRFL

3D structure

PDB

3pl9 Structural insights into energy regulation of light-harvesting complex CP29 from spinach.

Chain

Resolution

2.8 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CLA	A	F92 E96 H99 R202 M205 V206	F5 E9 H12 R115 M118 V119
BS02	CLA	A	R91 F92 C95 H99	R4 F5 C8 H12
BS03	CLA	A	L108 G109 T112 V113 A124 E128 S134 Y135 L136	L21 G22 T25 V26 A37 E41 S47 Y48 L49
BS04	CHL	A	E128 F142 L147 I150 E151 I155	E41 F55 L60 I63 E64 I68
BS05	CHL	A	Q122 G125 K126 L129 M144 E151	Q35 G38 K39 L42 M57 E64
BS06	CHL	A	R101 W102 I158 Q161 R162 E165 P174 T177 F178	R14 W15 I71 Q74 R75 E78 P87 T90 F91
BS07	CLA	A	C95 I98 H99 W102 I155 G156 E159 R162 N163	C8 I11 H12 W15 I68 G69 E72 R75 N76
BS08	CLA	A	R101 M104 Y173 P174 G175 F178 D179 L183 A184 L193 Q194 E197 H200	R14 M17 Y86 P87 G88 F91 D92 L96 A97 L106 Q107 E110 H113
BS09	CLA	A	I192 A196 K199 H200	I105 A109 K112 H113
BS10	CLA	A	L108 H200 L203	L21 H113 L116
BS11	CLA	A	G210 Q214 N225 H229 T237 I238	G123 Q127 N138 H142 T150 I151
BS12	CHL	A	W226 H229 L230 S231 P233 T237 L239	W139 H142 L143 S144 P146 T150 L152
BS13	CLA	A	L195 K199 R202 V206	L108 K112 R115 V119

Gene Ontology

	Molecular Function
GO:0016168	chlorophyll binding
GO:0051219	phosphoprotein binding

	Biological Process
GO:0009416	response to light stimulus
GO:0009765	photosynthesis, light harvesting
GO:0009768	photosynthesis, light harvesting in photosystem I
GO:0015979	photosynthesis

	Cellular Component
GO:0009507	chloroplast
GO:0009522	photosystem I
GO:0009523	photosystem II
GO:0009535	chloroplast thylakoid membrane
GO:0009579	thylakoid
GO:0009941	chloroplast envelope
GO:0010287	plastoglobule
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3pl9, PDBe:3pl9, PDBj:3pl9
PDBsum	3pl9
PubMed	21297637
UniProt	F2Z293

[Back to BioLiP]