Structure of PDB 3pio Chain A

Receptor sequence

>3pioA (length=253) Species: 1299 (Deinococcus radiodurans) [Search protein sequence]

DFSGLTKKRPEKALTEALPKTGGRNNRGRITSRFIGGGHKRLYRIIDFKR
RDKSGVNAKVAAIEYDPNRSARIALLHYADGEKRYILAPEGLTVGATVNA
GPEAEPKLGNALPLRFVPVGAVVHALELVPGKGAQLARSAGTSVQVQGKE
SDYVIVRLPSGELRRVHSECYATIGAVGNAEHKNIVLGKAGRSRWLGRKP
HQRGSAMNPVDHPHGGGEGRTGAGRVPVTPWGKPTKGLKTRRKRKTSDRF
IVT

3D structure

PDB

3pio Crystal structure of the synergistic antibiotic pair, lankamycin and lankacidin, in complex with the large ribosomal subunit.

Chain

Resolution

3.2473 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A	K27 K32 K40 T41 G42 G43 R44 N46 R47 G48 R49 I50 T51 R53 G56 H59 K60 R61 L62 Y63 R64 P87 N88 R89 H97 D100 K103 Q155 L156 A157 R158 S159 A160 Y173 L178 P179 S180 E182 R184 E189 E201 V206 L207 G208 K209 A210 R212 S213 R214 W215 R218 K219 P220 H221 Q222 R223 S225 A226 M227 N228 P229 V230 D231 H232 H234 G236 G237 E238 R240 G242 R245 P247 P250 K253 T255 K256 L258 R261 R262 K263 R264	K7 K12 K20 T21 G22 G23 R24 N26 R27 G28 R29 I30 T31 R33 G36 H39 K40 R41 L42 Y43 R44 P67 N68 R69 H77 D80 K83 Q135 L136 A137 R138 S139 A140 Y153 L158 P159 S160 E162 R164 E169 E181 V186 L187 G188 K189 A190 R192 S193 R194 W195 R198 K199 P200 H201 Q202 R203 S205 A206 M207 N208 P209 V210 D211 H212 H214 G216 G217 E218 R220 G222 R225 P227 P230 K233 T235 K236 L238 R241 R242 K243 R244

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0016740	transferase activity
GO:0019843	rRNA binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3pio, PDBe:3pio, PDBj:3pio
PDBsum	3pio
PubMed	21282615
UniProt	Q9RXJ9\|RL2_DEIRA Large ribosomal subunit protein uL2 (Gene Name=rplB)

[Back to BioLiP]