Structure of PDB 3pf5 Chain A |
>3pf5A (length=66) Species: 1423 (Bacillus subtilis) [Search protein sequence] |
MLEGKVKWFNSEKGFGFIEVEGQDDVFVHFSAIQGEGFKTLEEGQAVSFE IVEGNRGPQAANVTKE |
|
PDB | 3pf5 RNA single strands bind to a conserved surface of the major cold shock protein in crystals and solution. |
Chain | A |
Resolution | 1.68 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
A |
W8 F17 D25 |
W8 F17 D25 |
PDBbind-CN: Kd=336nM |
|
|
|