Structure of PDB 3pew Chain A

Receptor sequence

>3pewA (length=391) Species: 4932 (Saccharomyces cerevisiae)

AKSFDELGLAPELLKGIYAMKFQKPSKIQERALPLLLHNPPRNMIAQSQS
GTGKTAAFSLTMLTRVNPEDASPQAICLAPSRELARQTLEVVQEMGKFTK
ITSQLIVPDSFEKNKQINAQVIVGTPGTVLDLMRRKLMQLQKIKIFVLDE
ADNMLDQQGLGDQCIRVKRFLPKDTQLVLFSATFADAVRQYAKKIVPNAN
TLELQTNEVNVDAIKQLYMDCKNEADKFDVLTELYGVMTIGSSIIFVATK
KTANVLYGKLKSEGHEVSILHGDLQTQERDRLIDDFREGRSKVLITTNVL
ARGIDIPTVSMVVNYDLPTLANGQADPATYIHRIGRTGRFGRKGVAISFV
HDKNSFNILSAIQKYFGDIEMTRVPTDDWDEVEKIVKKVLK

3D structure

• PDB: 3pew A conserved mechanism of DEAD-box ATPase activation by nucleoporins and InsP(6) in mRNA export.
• Chain: A
• Resolution: 1.501 Å

Enzymatic activity

• Enzyme Commision number: 3.6.4.13: RNA helicase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A	P170 S171 P198 T215 G217 T218 Q247 Q248 G249 L250 Q253 A338 T339 K340 H361 G362 R369 T387 V389	P80 S81 P108 T125 G127 T128 Q157 Q158 G159 L160 Q163 A248 T249 K250 H271 G272 R279 T297 V299
BS02	ADP	A	F112 Q119 G141 G143 K144 T145 D395 R429 F430	F22 Q29 G51 G53 K54 T55 D305 R339 F340
BS03	BEF	A	S140 K144 R426 R429	S50 K54 R336 R339

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003724 RNA helicase activity
• GO:0005524 ATP binding

External links

• PDB: RCSB:3pew, PDBe:3pew, PDBj:3pew
• PDBsum: 3pew
• PubMed: 21441902
• UniProt: P20449|DBP5_YEAST ATP-dependent RNA helicase DBP5 (Gene Name=DBP5)