Structure of PDB 3pef Chain A

Receptor sequence

>3pefA (length=287) Species: 28232 (Geobacter metallireducens) [Search protein sequence]

SQKFGFIGLGIMGSAMAKNLVKAGCSVTIWNRSPEKAEELAALGAERAAT
PCEVVESCPVTFAMLADPAAAEEVCFGKHGVLEGIGEGRGYVDMSTVDPA
TSQRIGVAVVAKGGRFLEAPVSGSKKPAEDGTLIILAAGDRNLYDEAMPG
FEKMGKKIIHLGDVGKGAEMKLVVNMVMGGMMACFCEGLALGEKAGLATD
AILDVIGAGAMANPMFALKGGLIRDRNFAPAFPLKHMQKDLRLAVALGDR
VGQPLVASAAANELFKGARAAGFGDEDFSAIFKTYER

3D structure

PDB

3pef Structural characterization of a beta-hydroxyacid dehydrogenase from Geobacter sulfurreducens and Geobacter metallireducens with succinic semialdehyde reductase activity.

Chain

Resolution

2.07 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	NAP	A	G10 I11 M12 N31 R32 S33 K36 M64 L65 A66 A70 E73 T96 V121 G123 S124 A231 F232 H236 K239	G10 I11 M12 N31 R32 S33 K36 M64 L65 A66 A70 E73 T96 V121 G123 S124 A231 F232 H236 K239
BS02	GOL	A	G123 K171 N175 M178 F232	G123 K171 N175 M178 F232
BS03	GOL	A	D67 H236 K239 R242 R269	D67 H236 K239 R242 R269
BS04	GOL	A	L203 G207 N213 A217	L203 G207 N213 A217

Gene Ontology

	Molecular Function
GO:0000166	nucleotide binding
GO:0016491	oxidoreductase activity
GO:0016616	oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0050661	NADP binding
GO:0051287	NAD binding

	Biological Process
GO:0016054	organic acid catabolic process

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:3pef, PDBe:3pef, PDBj:3pef
PDBsum	3pef
PubMed	24878278
UniProt	Q39R98

[Back to BioLiP]