Structure of PDB 3pcy Chain A |
>3pcyA (length=99) Species: 3691 (Populus nigra) [Search protein sequence] |
IDVLLGADDGSLAFVPSEFSISPGEKIVFKNNAGFPHNIVFDEDSIPSGV DASKISMSEEDLLNAKGETFEVALSNKGEYSFYCSPHQGAGMVGKVTVN |
|
PDB | 3pcy The crystal structure of mercury-substituted poplar plastocyanin at 1.9-A resolution. |
Chain | A |
Resolution | 1.9 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
HG |
A |
H37 C84 H87 |
H37 C84 H87 |
|
|
|
|