Structure of PDB 3p6v Chain A

Receptor sequence

>3p6vA (length=398) Species: 303 (Pseudomonas putida)

NLAPLPPHVPEHLVFDFDMYNPSNLSAGVQEAWAVLQESNVPDLVWTRCN
GGHWIATRGQLIREAYEDYRHFSSECPFIPDFIPTSMDPPEQRQFRALAN
QVVGMPVVDKLENRIQELACSLIESLRPQGQCNFTEDYAEPFPIRIFMLL
AGLPEEDIPHLKYLTDQMTRPDGSMTFAEAKEALYDYLIPIIEQRRQKPG
TDAISIVANGQVNGRPITSDEAKRMCGLLLVGGLDTVVNFLSFSMEFLAK
SPEHRQELIERPERIPAACEELLRRFSLVADGRILTSDYEFHGVQLKKGD
QILLPQMLSGLDERENAAPMHVDFSRQKVSHTTFGHGSHLCLGQHLARRE
IIVTLKEWLTRIPDFSIAPGAQIQHKSGIVSGVQALPLVWDPATTKAV

3D structure

• PDB: 3p6v Crystal Structure of Cytochrome P450cam crystallized in the presence of a tethered substrate analog 3Et-AdaC1-Etg-Boc
• Chain: A
• Resolution: 2.0 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): R186 G248 D251 T252 V253 C357 L358 G359 E366 V396
• Catalytic site (residue number reindexed from 1): R170 G232 D235 T236 V237 C341 L342 G343 E350 V380
• Enzyme Commision number: 1.14.15.1: camphor 5-monooxygenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	A	P100 Q108 R112 G248 G249 T252 D297 R299 Q322 F350 G351 H355 C357 G359 A363	P84 Q92 R96 G232 G233 T236 D281 R283 Q306 F334 G335 H339 C341 G343 A347

Gene Ontology

Molecular Function

• GO:0004497 monooxygenase activity
• GO:0005506 iron ion binding
• GO:0005515 protein binding
• GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
• GO:0018683 camphor 5-monooxygenase activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0019383 (+)-camphor catabolic process

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:3p6v, PDBe:3p6v, PDBj:3p6v
• PDBsum: 3p6v
• UniProt: P00183|CPXA_PSEPU Camphor 5-monooxygenase (Gene Name=camC)