Structure of PDB 3p6q Chain A

Receptor sequence

>3p6qA (length=401) Species: 303 (Pseudomonas putida)

NLAPLPPHVPEHLVFDFDMYNPSNLSAGVQEAWAVLQESNVPDLVWTRCN
GGHWIATRGQLIREAYEDYRHFSSECPFIPREYDFIPTSMDPPEQRQFRA
LANQVVGMPVVDKLENRIQELACSLIESLRPQGQCNFTEDYAEPFPIRIF
MLLAGLPEEDIPHLKYLTDQMTRPDGSMTFAEAKEALYDYLIPIIEQRRQ
KPGTDAISIVANGQVNGRPITSDEAKRMCGLLLVGGLDTVVNFLSFSMEF
LAKSPEHRQELIERPERIPAACEELLRRFSLVADGRILTSDYEFHGVQLK
KGDQILLPQMLSGLDERENAAPMHVDFSRQKVSHTTFGHGSHLCLGQHLA
RREIIVTLKEWLTRIPDFSIAPGAQIQHKSGIVSGVQALPLVWDPATTKA
V

3D structure

• PDB: 3p6q Crystal Structure of Cytochrome P450cam crystallized in the presence of a tethered substrate analog AdaC2-Etg-Boc
• Chain: A
• Resolution: 1.95 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): R186 G248 D251 T252 V253 C357 L358 G359 E366 V396
• Catalytic site (residue number reindexed from 1): R173 G235 D238 T239 V240 C344 L345 G346 E353 V383
• Enzyme Commision number: 1.14.15.1: camphor 5-monooxygenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	A	P100 R112 L244 L245 G248 G249 T252 V253 D297 R299 Q322 T349 F350 G351 H355 C357 G359 A363	P87 R99 L231 L232 G235 G236 T239 V240 D284 R286 Q309 T336 F337 G338 H342 C344 G346 A350

Gene Ontology

Molecular Function

• GO:0004497 monooxygenase activity
• GO:0005506 iron ion binding
• GO:0005515 protein binding
• GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
• GO:0018683 camphor 5-monooxygenase activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0019383 (+)-camphor catabolic process

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:3p6q, PDBe:3p6q, PDBj:3p6q
• PDBsum: 3p6q
• UniProt: P00183|CPXA_PSEPU Camphor 5-monooxygenase (Gene Name=camC)