Structure of PDB 3p6g Chain A

Receptor sequence

>3p6gA (length=139) Species: 9606 (Homo sapiens) [Search protein sequence]

QQMGRGSMCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMII
SVNGDVITIKSESTFKNTEISFILGQEFDEVTADDRKVKSTITLDGGVLV
HVQKWDGKSTTIKRKREDDKLVVECVMKGVTSTRVYERA

3D structure

PDB

3p6g Structural analysis of ibuprofen binding to human adipocyte fatty-acid binding protein (FABP4).

Chain

Resolution

1.2 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	IZP	A	R78 R126 Y128	R86 R134 Y136

Gene Ontology

	Molecular Function
GO:0005324	long-chain fatty acid transmembrane transporter activity
GO:0005504	fatty acid binding
GO:0008289	lipid binding
GO:0036041	long-chain fatty acid binding
GO:0051427	hormone receptor binding

	Biological Process
GO:0009617	response to bacterium
GO:0015908	fatty acid transport
GO:0015909	long-chain fatty acid transport
GO:0042632	cholesterol homeostasis
GO:0045892	negative regulation of DNA-templated transcription
GO:0050729	positive regulation of inflammatory response
GO:0050872	white fat cell differentiation
GO:0050873	brown fat cell differentiation
GO:0071285	cellular response to lithium ion
GO:0071356	cellular response to tumor necrosis factor
GO:0120162	positive regulation of cold-induced thermogenesis

External links

PDB	RCSB:3p6g, PDBe:3p6g, PDBj:3p6g
PDBsum	3p6g
PubMed	25664790
UniProt	P15090\|FABP4_HUMAN Fatty acid-binding protein, adipocyte (Gene Name=FABP4)