Structure of PDB 3p1d Chain A |
>3p1dA (length=115) Species: 9606 (Homo sapiens) [Search protein sequence] |
KIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNP MDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLA EVFEQEIDPVMQSLG |
|
PDB | 3p1d Histone recognition and large-scale structural analysis of the human bromodomain family. |
Chain | A |
Resolution | 1.86 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MB3 |
A |
V1115 N1168 |
V33 N86 |
PDBbind-CN: -logKd/Ki=2.64,IC50=2.3mM BindingDB: IC50=2300000nM |
|
|
|