Structure of PDB 3ozb Chain A

Receptor sequence

>3ozbA (length=241) Species: 208964 (Pseudomonas aeruginosa PAO1)

MSVYAIIGGTGLTQLEGLTLSESLPIETPYGAPSAPLQRGRYAGREVLFL
ARHGHFPPHQVNYRANLWALKQAGAEAVIAVNAVGGIHAAMGTGHLCVPH
QLIDYTSGREHTYFAGDIEHVTHIDFSHPYDEPLRQRLIEALRALGLAHS
SHGVYACTQGPRLETVAEIARLERDGNDIVGMTGMPEAALARELDLPYAC
LALVVNPAAGKSAGIITMAEIEQALHDGIGKVREVLARVLA

3D structure

• PDB: 3ozb Methylthioinosine phosphorylase from Pseudomonas aeruginosa. Structure and annotation of a novel enzyme in quorum sensing.
• Chain: A
• Resolution: 2.8 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): T24 P47 F73 P74 A100 M199 T200 N223 A225 M235
• Catalytic site (residue number reindexed from 1): T10 P33 F56 P57 A83 M182 T183 N206 A208 M218
• Enzyme Commision number: 2.4.2.44: S-methyl-5'-thioinosine phosphorylase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HPA	A	A100 V101 G102 L180 E181 V197 G198 M199 N223	A83 V84 G85 L163 E164 V180 G181 M182 N206

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0016757 glycosyltransferase activity
• GO:0016763 pentosyltransferase activity
• GO:0017061 S-methyl-5-thioadenosine phosphorylase activity

Biological Process

• GO:0006166 purine ribonucleoside salvage
• GO:0009116 nucleoside metabolic process
• GO:0019509 L-methionine salvage from methylthioadenosine

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:3ozb, PDBe:3ozb, PDBj:3ozb
• PDBsum: 3ozb
• PubMed: 21197954
• UniProt: Q9HZK1|MTIP_PSEAE S-methyl-5'-thioinosine phosphorylase (Gene Name=PA3004)